{"id":88700,"date":"2026-03-01T19:15:58","date_gmt":"2026-03-01T18:15:58","guid":{"rendered":"https:\/\/heloa.app\/?p=88700"},"modified":"2026-03-01T19:15:58","modified_gmt":"2026-03-01T18:15:58","slug":"daylight-saving-time-baby-sleep","status":"publish","type":"post","link":"https:\/\/heloa.app\/en-in\/blog\/0-12-months\/sleep\/daylight-saving-time-baby-sleep","title":{"rendered":"Daylight saving time baby sleep: help your baby adjust fast"},"content":{"rendered":"<p>That one-hour clock change can flip your whole day. Your baby suddenly fights sleep, wakes &#8220;too early&#8221;, or asks for a nap at an unusual time. Confusing, yes. Exhausting too. The reassuring bit: most babies resynchronise within days when you give clear time cues (light, feeds, a predictable rhythm) so <strong>overtiredness<\/strong> doesn&#8217;t pile up.<\/p> <p>If you&#8217;re trying to make sense of <strong>daylight saving time baby sleep<\/strong>, you&#8217;ll likely want three things: what&#8217;s happening in the body, which ages react most, and a plan that still works with daycare, grandparents, or two-home routines.<\/p> <h2 id=\"daylightsavingtimebabysleepwhatchangesinthebodyandwhyonehourmatters\">Daylight saving time baby sleep: what changes in the body (and why one hour matters)<\/h2> <p>Baby sleep runs on two engines that overlap.<\/p> <ul> <li><strong>Circadian rhythm<\/strong>: the internal 24-hour clock, largely tuned by <strong>natural light exposure<\/strong> and daily patterns.<\/li> <li><strong>Sleep pressure<\/strong>: the drive to sleep that builds the longer your baby stays awake (think of it as a sleep tank filling up).<\/li> <\/ul> <p>Daylight saving time changes the wall clock instantly. Your baby&#8217;s brain doesn&#8217;t update instantly. Signals like sleepiness, appetite, and alert periods still arrive on the old timing for a while. Adults can push through. Babies can&#8217;t, because their anchors are repetitive and physical: feeds, wake windows, naps, and the bedtime routine.<\/p> <p>The result? A mismatch. The clock says bed, but <strong>melatonin<\/strong> (the hormone that supports sleep onset) may not be rising yet. Or the clock says morning, but the body still behaves like it&#8217;s night.<\/p> <h3 id=\"springforwardvsfallbacklosingorgaininganhour\">Spring forward vs fall back (losing or gaining an hour)<\/h3> <ul> <li><strong>Spring forward<\/strong>: the clock jumps ahead. Bedtime can feel too early, evenings can get fussy, and naps may slide later for a few days.<\/li> <li><strong>Fall back<\/strong>: you gain an hour, but many babies treat it like an earlier morning. A 5 a.m. wake is often just the same biological wake time with a new label.<\/li> <\/ul> <h3 id=\"lightmelatonincortisolthethreetimesetters\">Light, melatonin, cortisol: the three time-setters<\/h3> <p>Light is the strongest synchronising cue.<\/p> <ul> <li><strong>Morning light<\/strong> suppresses melatonin and supports alertness. It also shapes <strong>cortisol<\/strong> rhythms (cortisol helps the body wake up and get going).<\/li> <li><strong>Evening darkness<\/strong> allows melatonin to rise, easing sleep onset.<\/li> <\/ul> <p>Here&#8217;s the tricky part: after the clock change, the sun doesn&#8217;t shift with your watch. In spring, brighter evenings can delay sleepiness. In fall, darker mornings can keep your child in night mode.<\/p> <p>A practical rhythm that suits many Indian households (busy mornings, late sunsets in some seasons): strong morning daylight, then a steady tapering of stimulation and light from late afternoon onwards.<\/p> <h3 id=\"mealsnapsandbedtimeroutinedailycuesthatreinforcetheclock\">Meals, naps, and bedtime routine: daily cues that reinforce the clock<\/h3> <p>Light leads, but it&#8217;s not alone. Meal timing, wake windows, naps, and a familiar bedtime routine act like steady beats for the brain.<\/p> <p>Some babies adjust with barely a protest. Others seem out of sorts: hungry earlier, bedtime agitation, early waking. That&#8217;s not a bad habit created in 48 hours. It&#8217;s adaptation.<\/p> <h3 id=\"whatparentscommonlynotice\">What parents commonly notice<\/h3> <p>Right after the change, <strong>daylight saving time baby sleep<\/strong> disruption often looks like:<\/p> <ul> <li>early morning waking  <\/li> <li>bedtime false starts (baby falls asleep, then wakes soon after)  <\/li> <li>shorter naps or naps drifting unpredictably  <\/li> <li>late-afternoon fussiness (sleep debt builds quickly)  <\/li> <li>more night wakings while circadian timing and sleep pressure re-align  <\/li> <li>appetite shifts and sometimes mild digestive changes (gas, stool pattern changes)<\/li> <\/ul> <h2 id=\"whichbabiesaremostsensitivetothetimechange\">Which babies are most sensitive to the time change?<\/h2> <h3 id=\"newborns03monthsflexiblerhythmsdifferentpriorities\">Newborns (0-3 months): flexible rhythms, different priorities<\/h3> <p>Newborn sleep is driven mostly by feeding and comfort, the circadian system is still organising. Many families notice the clock looks odd, but baby behaves like a newborn. Focus on safe sleep and clear day-night contrast (bright days, dim calm nights) rather than fixing timings.<\/p> <h3 id=\"babiesunder6monthsthebodyclockisstillmaturing\">Babies under 6 months: the body clock is still maturing<\/h3> <p>Sleep cycles are shorter, feeds shape the day, and schedules are often less fixed. Watching sleepy cues and offering sleep without a tug-of-war with the clock tends to work best.<\/p> <h3 id=\"babies36monthspatternsstarttostabilise\">Babies 3-6 months: patterns start to stabilise<\/h3> <p>Naps become more predictable, nights may consolidate, and routines suddenly matter. A one-hour shift can bring nap misalignment and longer settling at bedtime. Consistent morning light and the same bedtime routine steps can speed up the reset.<\/p> <h3 id=\"babies612monthsovertirednessbuildsfast\">Babies 6-12 months: overtiredness builds fast<\/h3> <p>This age often reacts strongly. Sleep is more consolidated, so misalignment shows up clearly: early wakes, trouble settling, naps that stop fitting. A common loop appears:<\/p> <p>fatigue builds -&gt; settling gets harder -&gt; sleep fragments -&gt; fatigue builds again.<\/p> <p>Protecting naps and avoiding very long evenings can break this cycle.<\/p> <h3 id=\"toddlers1224monthsstallingresistanceoccasionalsplitnights\">Toddlers (12-24+ months): stalling, resistance, occasional split nights<\/h3> <p>Toddlers rely heavily on routine cues and may test boundaries when tired. After the change you might see bedtime stalling, nap resistance, or a split night if the schedule drifts.<\/p> <h3 id=\"temperamentandchronicpoorsleepers\">Temperament and chronic poor sleepers<\/h3> <p>Some babies are more sensitive: harder to soothe, less adaptable, already waking often. With them, go smaller and steadier. Keep nights boring: low light, minimal talking, consistent responses.<\/p> <h2 id=\"choosingaschedulestrategythatfitsyourfamily\">Choosing a schedule strategy that fits your family<\/h2> <p>There isn&#8217;t one perfect method for <strong>daylight saving time baby sleep<\/strong>. Pick the plan that matches your constraints.<\/p> <h3 id=\"gradualshift1015minutesperday\">Gradual shift (10-15 minutes per day)<\/h3> <p>Move wake time, naps, meals, and bedtime by 10-15 minutes daily for 4-7 days. Gentle, and often easier for babies 6-12 months and toddlers.<\/p> <p>Two common variations:<\/p> <ul> <li>10-15 minutes per day for 4 days (very sensitive sleepers)  <\/li> <li>30 minutes per day for 2 days (more adaptable babies)<\/li> <\/ul> <h3 id=\"samedayreset\">Same-day reset<\/h3> <p>Switch immediately to the new time. This can be simpler if daycare and work timings are fixed. Expect a few wobbly days, spring forward tends to feel rougher.<\/p> <h3 id=\"hybridapproach\">Hybrid approach<\/h3> <p>Shift a little before, then complete the rest after the change. Many families end up here naturally.<\/p> <h3 id=\"ifdaycarewontcooperate\">If daycare won&#8217;t cooperate<\/h3> <p>You can still anchor mornings and evenings at home. Keep bedtime protected, and use light strategically. If your child comes home cranky, an earlier bedtime for a couple of nights can be a sensible repair.<\/p> <h2 id=\"aoneweekadjustmentplanyoucanactuallyfollow\">A one-week adjustment plan you can actually follow<\/h2> <h3 id=\"movethekeyanchorstogether\">Move the key anchors together<\/h3> <p>Choose your target wake time on the new clock. Then shift:<\/p> <ul> <li>wake time  <\/li> <li>nap offers  <\/li> <li>meal times  <\/li> <li>bedtime  <\/li> <\/ul> <p>\u2026all in the same direction by 10-15 minutes daily. Regularity matters more than landing on the exact minute.<\/p> <h3 id=\"keepthebedtimeroutineidenticalorderbeatsclocktime\">Keep the bedtime routine identical (order beats clock time)<\/h3> <p>Bath, nappy, feed, story, song, cuddle, bed: whatever your sequence is, keep it stable. The order itself becomes a cue.<\/p> <h3 id=\"usewakewindowsandcaplatenapsifneeded\">Use wake windows and cap late naps if needed<\/h3> <p>Wake windows are a better compass than the clock during transitions.<\/p> <ul> <li>Allow 5-15 minutes of flexibility.  <\/li> <li>If the last nap runs late, consider capping it so bedtime doesn&#8217;t drift.  <\/li> <li>A short bridging nap (10-20 minutes) can rescue a day that&#8217;s stretching too long.<\/li> <\/ul> <h3 id=\"shiftfeedsbutdontignorehunger\">Shift feeds, but don&#8217;t ignore hunger<\/h3> <p>Hunger cues may lag behind the clock for a few days. Nudge feeds gradually, yet respond if your baby is truly hungry. A hungry baby rarely settles well.<\/p> <h3 id=\"movedailyanchorstoowalksbalconytimebath\">Move daily anchors too (walks, balcony time, bath)<\/h3> <p>In many Indian homes, daylight exposure can be limited by heat, pollution, or apartment living. Even then, you can use what&#8217;s available:<\/p> <ul> <li>10-20 minutes on the balcony or near a bright window after wake-up  <\/li> <li>a morning walk when air quality allows  <\/li> <li>bath and wind-down at the new target time  <\/li> <\/ul> <p>Light plus routine is a powerful pairing.<\/p> <h3 id=\"exampleschedulesadjusttoyourchild\">Example schedules (adjust to your child)<\/h3> <p>These are sample shapes of a day. Modify based on wake windows.<\/p> <ul> <li><p><strong>3 naps<\/strong> (often younger infants)  <\/p><\/li> <li><p>Wake 7:00  <\/p><\/li> <li><p>Nap 1 9:30-11:00  <\/p><\/li> <li><p>Nap 2 13:30-15:00  <\/p><\/li> <li><p>Nap 3 17:15-17:45 (often capped)  <\/p><\/li> <li><p>Bed 19:00  <\/p><\/li> <li><p><strong>2 naps<\/strong> (often 6-12 months)  <\/p><\/li> <li><p>Wake 7:00  <\/p><\/li> <li><p>Nap 1 9:45-11:00  <\/p><\/li> <li><p>Nap 2 14:00-15:30  <\/p><\/li> <li><p>Bed 19:00  <\/p><\/li> <li><p><strong>1 nap<\/strong> (often toddlers)  <\/p><\/li> <li><p>Wake 7:00  <\/p><\/li> <li><p>Nap 12:00-14:00  <\/p><\/li> <li><p>Bed 19:00  <\/p><\/li> <\/ul> <p>To adjust gradually, shift every point by 10-15 minutes per day.<\/p> <h2 id=\"lightandsleepenvironmentthatspeedupadjustment\">Light and sleep environment that speed up adjustment<\/h2> <h3 id=\"morninglightthefastestreset\">Morning light: the fastest reset<\/h3> <p>After wake-up, aim for 15-30 minutes of bright light (outside if possible, otherwise near a bright window). This helps the body clock advance and supports earlier sleepiness later.<\/p> <h3 id=\"eveninglightespeciallyimportantinspring\">Evening light: especially important in spring<\/h3> <p>Dim lights about an hour before bed. Keep play calm. Prefer warm, soft lighting.<\/p> <h3 id=\"fallbackhandleveryearlymorningswithoutreinforcingthem\">Fall back: handle very early mornings without reinforcing them<\/h3> <p>If baby wakes too early, keep the room dark and interactions minimal until your chosen start-the-day time. Save bright light, breakfast, and lively play for that time.<\/p> <h3 id=\"darknessbasics\">Darkness basics<\/h3> <ul> <li><strong>Blackout curtains<\/strong> help with early sunrises.  <\/li> <li>If you use a night light, pick a dim, warm-toned one placed away from baby&#8217;s direct line of sight.<\/li> <\/ul> <h2 id=\"springforwardplanlosinganhour\">Spring forward plan (losing an hour)<\/h2> <h3 id=\"whatyoumaysee\">What you may see<\/h3> <p>Spring forward can feel like mild jet lag: longer time to fall asleep, bedtime agitation, naps sliding later, and late-day irritability.<\/p> <h3 id=\"bedtimeoptions\">Bedtime options<\/h3> <ul> <li><strong>Gradual<\/strong>: shift earlier by 10-15 minutes daily.  <\/li> <li><strong>Hybrid<\/strong>: shift a bit before, complete after.  <\/li> <li><strong>No-prep<\/strong>: switch on the day and expect a bumpier few days.<\/li> <\/ul> <h3 id=\"protectnapsandbedtime\">Protect naps and bedtime<\/h3> <p>If naps shorten, add a short catnap so bedtime doesn&#8217;t slide too late. If your baby is clearly overtired, a temporary earlier bedtime (15-30 minutes) for 2-3 nights can repay sleep debt.<\/p> <h2 id=\"fallbackplangaininganhour\">Fall back plan (gaining an hour)<\/h2> <h3 id=\"why5amwakeupshappen\">Why 5 a.m. wake-ups happen<\/h3> <p>It&#8217;s often the same biological wake time as before the shift. Reframe it as a phase.<\/p> <h3 id=\"shiftthedaylater\">Shift the day later<\/h3> <p>Move bedtime later by 10-15 minutes per day, and move naps later too. If naps creep too early, stretch wake windows slightly (5-15 minutes) so bedtime stays protected.<\/p> <h3 id=\"preventingsplitnights\">Preventing split nights<\/h3> <p>Split nights often show up when there isn&#8217;t enough sleep pressure or bedtime becomes too early. Cap late naps if needed. Keep nights boring and consistent.<\/p> <h2 id=\"napswakewindowsandovertirednesswhatnottodo\">Naps, wake windows, and overtiredness: what not to do<\/h2> <h3 id=\"dontskipnapstoreachbedtime\">Don&#8217;t skip naps to reach bedtime<\/h3> <p>It&#8217;s tempting. It often backfires. An overtired baby may look wired, cry more, and wake more overnight.<\/p> <h3 id=\"catnapscansavetheday\">Catnaps can save the day<\/h3> <p>A 10-20 minute late-afternoon catnap can protect bedtime. Keep it short so it doesn&#8217;t steal night sleep pressure.<\/p> <h2 id=\"feedingandnightwakingsaroundthetimechange\">Feeding and night wakings around the time change<\/h2> <p>Appetite rhythms are linked to sleep and light. When sleep shifts, hunger can appear at odd times for a few days.<\/p> <ul> <li>Shift feeds gradually with the day.  <\/li> <li>Keep night feeds low-light and calm.  <\/li> <li>If baby wakes without hunger cues, soothe first, feed when hunger is clear.<\/li> <\/ul> <h2 id=\"traveldaycareandtwohomeroutines\">Travel, daycare, and two-home routines<\/h2> <p>If your baby is at daycare, share the target wake time and nap windows. If daycare naps are fixed, protect bedtime at home for a week. With two households, agree on shared anchors: wake time range, nap window, bedtime routine order.<\/p> <h2 id=\"troubleshootingcommonproblemsaftertheclockchange\">Troubleshooting common problems after the clock change<\/h2> <h3 id=\"earlymorningwaking\">Early morning waking<\/h3> <p>Keep mornings dim and quiet until your set start time, then use bright light and breakfast to anchor the new schedule. Shift wake time in small steps.<\/p> <h3 id=\"bedtimemeltdownsandfalsestarts\">Bedtime meltdowns and false starts<\/h3> <p>Check the last wake window: too long can drive overtiredness, too short can reduce sleep pressure. Cap late naps and keep wind-down calm.<\/p> <h3 id=\"morenightwakings\">More night wakings<\/h3> <p>A few extra wakings for several days can be normal during <strong>daylight saving time baby sleep<\/strong> adjustment. Many families see improvement within a week, some take up to two.<\/p> <h3 id=\"moodappetitedigestion\">Mood, appetite, digestion<\/h3> <p>Short-term changes can happen because sleep and feeding affect each other. Keep days simple: morning light, age-appropriate naps, calm evenings, responsive feeding.<\/p> <h2 id=\"whenthingsusuallyreturntobaseline\">When things usually return to baseline<\/h2> <p>Often, adjustment takes 4-7 days. After about 6 months, 7-10 days is common, especially if sleep debt built up. Some sensitive sleepers may take up to two weeks.<\/p> <p>Signs you&#8217;re adjusted:<\/p> <ul> <li>bedtime and wake time look steady on the new clock  <\/li> <li>naps land in predictable windows again  <\/li> <li>easier settling and fewer early wakes  <\/li> <li>mood and appetite feel like the usual baseline  <\/li> <\/ul> <h2 id=\"whentoseekmedicaladviceandkeepsleepsafe\">When to seek medical advice and keep sleep safe<\/h2> <p>Speak to your paediatrician if sleep disruption lasts beyond 1-2 weeks without improvement, if crying suggests pain, if feeds drop significantly, or if there are dehydration signs (fewer wet nappies, dry mouth).<\/p> <p>Sometimes a clock change coincides with something else: reflux symptoms, rhinitis, ear infection, teething pain, or breathing discomfort (unusual snoring, laboured breathing). New symptoms deserve a check.<\/p> <p>Safe sleep remains the foundation:<\/p> <ul> <li>baby on the back  <\/li> <li>firm, flat sleep surface  <\/li> <li>no pillows, loose blankets, or bumpers  <\/li> <li>comfortable room temperature, often around 16-20\u00b0C (adjust for your home and baby)<\/li> <\/ul> <h2 id=\"keytakeaways\">Key takeaways<\/h2> <ul> <li><strong>Daylight saving time baby sleep<\/strong> disruption happens because babies follow biological timing and light cues, not the wall clock.  <\/li> <li>Morning daylight is your strongest reset tool, dim evenings support melatonin.  <\/li> <li>Shift the main anchors together: wake, naps, meals, bedtime routine.  <\/li> <li>Protect naps to prevent overtiredness, which can worsen settling and night waking.  <\/li> <li>Most babies adjust within days to two weeks, depending on age and temperament.  <\/li> <li>For personalised tips and free child health questionnaires, you can download the <a href=\"https:\/\/app.adjust.com\/1g586ft8\" target=\"_blank\" rel=\"noopener\">Heloa app<\/a>.<\/li> <\/ul> <p><img decoding=\"async\" src=\"https:\/\/heloa.app\/wp-content\/uploads\/2026\/02\/changement-dheure-et-sommeil-bebe-in-article-image.jpg\" width=\"628\" alt=\"Baby playing on a rug in the morning while the parent opens the curtains to manage daylight saving time and baby sleep\" \/><\/p> <p>Further reading:<\/p> <ul> <li><a href=\"https:\/\/www.chop.edu\/news\/health-tip\/5-ways-help-kids-adjust-daylight-saving-time\" target=\"_blank\" rel=\"noopener\">5 Ways to Help Kids Adjust to Daylight Saving Time<\/a><\/li> <\/ul>","protected":false},"excerpt":{"rendered":"<p>Daylight saving time baby sleep can mean earlier wake-ups and wobbly naps. Try a gentle 7-day shift plan with light timing, feeds, and wake-window cues\u2014steady, calm, doable.<\/p>\n","protected":false},"author":4,"featured_media":87790,"comment_status":"closed","ping_status":"","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"_kad_blocks_custom_css":"","_kad_blocks_head_custom_js":"","_kad_blocks_body_custom_js":"","_kad_blocks_footer_custom_js":"","_kad_post_transparent":"","_kad_post_title":"","_kad_post_layout":"","_kad_post_sidebar_id":"","_kad_post_content_style":"","_kad_post_vertical_padding":"","_kad_post_feature":"","_kad_post_feature_position":"","_kad_post_header":false,"_kad_post_footer":false,"_kad_post_classname":"","rank_math_title":"Daylight saving time baby sleep: 7-day plan for smoother nights","rank_math_description":"Daylight saving time baby sleep can mean earlier wake-ups and wobbly naps. Try a gentle 7-day shift plan with light timing, feeds, and wake-window cues\u2014steady, calm, doable.","rank_math_focus_keyword":"daylight saving time baby sleep","rank_math_primary_category":826,"ilj_linkdefinition":["daylight saving time {-2} baby sleep","daylight saving time {-1} baby sleep changes","daylight saving time {-1} baby sleep schedule","daylight saving time {-1} baby sleep tips","baby sleep {-2} daylight saving time","baby sleep during daylight saving time","baby sleep after daylight saving time","baby sleep and daylight saving time","baby sleep {-2} time change","baby sleep {-2} clock change","baby sleep {-2} spring forward","baby sleep {-2} fall back","baby sleep after {-2} clock change","baby sleep {-2} time shift","baby sleep {-2} schedule change","infant sleep {-2} time change","newborn sleep {-2} time change","toddler sleep {-2} time change","baby sleep {-2} daylight savings","daylight savings time {-2} baby sleep"],"footnotes":""},"categories":[826,812],"tags":[],"class_list":["post-88700","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-sleep-0-12-months-3","category-0-12-months-en-in"],"acf":{"prestation_table":"","technical_table":"","nom_professionnel":"","numero_telephone":"","convention_cas":"","contrat_acces_aux_soins":"","sesam_vitale":"","coordonnees":"","adresse":"","profession":"","numero_rpps":"","profession_description":"","commune":"","departement":"","prenom":"","origine":"","date_fete":"","signification_etymologie":"","histoire_origine_prenom":"","personne_celebre":"","age_moyen":"","prenoms_derives":"","prenoms_composes":"","naissances_2024":"","genre":"","prenoms_taxonomy":"","region_stats":"","evolution_naissances":""},"taxonomy_info":{"category":[{"value":826,"label":"Sleep"},{"value":812,"label":"0-12 months"}]},"featured_image_src_large":["https:\/\/heloa.app\/wp-content\/uploads\/2026\/02\/changement-dheure-et-sommeil-bebe-featured-image-1024x559.jpg",1024,559,true],"author_info":{"display_name":"Heloa","author_link":"https:\/\/heloa.app\/en-in\/author\/expert-heloa"},"comment_info":0,"category_info":[{"term_id":826,"name":"Sleep","slug":"sleep-0-12-months-3","term_group":0,"term_taxonomy_id":826,"taxonomy":"category","description":"","parent":812,"count":39,"filter":"raw","cat_ID":826,"category_count":39,"category_description":"","cat_name":"Sleep","category_nicename":"sleep-0-12-months-3","category_parent":812},{"term_id":812,"name":"0-12 months","slug":"0-12-months-en-in","term_group":0,"term_taxonomy_id":812,"taxonomy":"category","description":"Understand your baby\u2019s growth from 0 to 12 months. From smiling, waving, learning to talk and walk, eating on their own, to supporting them in handling their emotions \u2014 we\u2019ve got everything covered for you.","parent":0,"count":287,"filter":"raw","cat_ID":812,"category_count":287,"category_description":"Understand your baby\u2019s growth from 0 to 12 months. From smiling, waving, learning to talk and walk, eating on their own, to supporting them in handling their emotions \u2014 we\u2019ve got everything covered for you.","cat_name":"0-12 months","category_nicename":"0-12-months-en-in","category_parent":0}],"tag_info":false,"_links":{"self":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88700","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/users\/4"}],"replies":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/comments?post=88700"}],"version-history":[{"count":1,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88700\/revisions"}],"predecessor-version":[{"id":88701,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88700\/revisions\/88701"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/media\/87790"}],"wp:attachment":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/media?parent=88700"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/categories?post=88700"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/tags?post=88700"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}