{"id":88024,"date":"2026-02-19T18:40:35","date_gmt":"2026-02-19T17:40:35","guid":{"rendered":"https:\/\/heloa.app\/?p=88024"},"modified":"2026-02-19T18:40:35","modified_gmt":"2026-02-19T17:40:35","slug":"parent-time-management","status":"publish","type":"post","link":"https:\/\/heloa.app\/en-in\/blog\/parents\/daily-life\/parent-time-management","title":{"rendered":"Parent time management: a realistic, biology-aware system for busy parents"},"content":{"rendered":"<p>Time can feel like it has started running on &#8220;Indian Standard Time&#8221; the day a baby arrives\u2014always a little behind, always getting stretched. Between school WhatsApp groups, commute traffic, tiffin planning, house-help schedules, and a child who needs you <em>right now<\/em>, <strong>parent time management<\/strong> stops being a neat planner exercise. It becomes a health-and-stability practice: protect sleep, reduce daily friction, and keep the home rhythm predictable enough for children&#8217;s nervous systems (and yours) to settle.<\/p> <p>You may be thinking, &#8220;I&#8217;m busy from morning to night\u2026 so why do I still feel unfinished?&#8221; That feeling is common, and it has biology behind it. Fragmented sleep, constant interruptions, and the mental load of caregiving change how the brain plans, remembers, and regulates emotions.<\/p> <h2 id=\"whytimefeelsharderafterkidsandwhyitsnotyourfault\">Why time feels harder after kids (and why it&#8217;s not your fault)<\/h2> <h3 id=\"whatparenttimemanagementactuallymeanswithchildren\">What &#8220;parent time management&#8221; actually means with children<\/h3> <p>In real <strong>parent time management<\/strong>, you are balancing three types of time\u2014often in the same hour:<\/p> <ul> <li><strong>Essential time:<\/strong> what supports growth and health (sleep, meals, hygiene, school, caregiving, connection).<\/li> <li><strong>Constrained time:<\/strong> non-negotiables (commutes, prep, cooking, cleaning, bills, forms).<\/li> <li><strong>Personal recovery time:<\/strong> usually the first to get cut, even though it resets the <strong>nervous system<\/strong> (rest, movement, quiet).<\/li> <\/ul> <p>When recovery time shrinks, a domino effect can show up: routines drift, children become more dysregulated (more crying, more resistance, more meltdowns), bedtime stretches, and tension rises at home. The aim is not to &#8220;finish everything.&#8221; The aim is to protect what keeps both parent and child steady.<\/p> <h3 id=\"thehiddenworkloadmentalloadinterruptionsandtaskswitching\">The hidden workload: mental load, interruptions, and task switching<\/h3> <p>Parenting adds work that rarely appears on a list: anticipating needs, remembering vaccination dates, tracking school requirements, planning meals, keeping spare clothes, monitoring screen time, organising transport. This is <strong>mental load<\/strong>\u2014the brain work that uses <strong>working memory<\/strong>, sustained attention, and <strong>executive function<\/strong> (planning, prioritising, self-control, flexibility).<\/p> <p>And multitasking? Most of the time, it is not parallel work. Attention keeps switching. Every interruption creates a restart cost: you lose your place, you re-check, you rebuild focus. That&#8217;s why a day full of activity can still feel like &#8220;nothing got done.&#8221;<\/p> <h3 id=\"whytypicalproductivityadvicedoesntfitcaregivers\">Why typical productivity advice doesn&#8217;t fit caregivers<\/h3> <p>Many productivity systems assume you control your environment and can block long uninterrupted time. Parenting is the opposite: children need supervision, connection, and help with transitions, and that&#8217;s developmentally appropriate.<\/p> <p>Sleep disruption matters a lot. With sleep deprivation, the prefrontal cortex works less efficiently, and you may notice:<\/p> <ul> <li>more forgetting (where are the keys?)<\/li> <li>more re-checking (did I reply to the teacher?)<\/li> <li>slower decisions (what to cook, what to pack)<\/li> <li>lower frustration tolerance<\/li> <\/ul> <p>If you are postpartum, add physical recovery and hormonal changes (for example, shifts in oestrogen and progesterone), and &#8220;brain fog&#8221; can become very real. Feeling slower is not laziness, it&#8217;s physiology.<\/p> <h3 id=\"thesamebusydayfeelsdifferentatdifferentages\">The same busy day feels different at different ages<\/h3> <p>Children&#8217;s development changes your constraints:<\/p> <ul> <li><strong>Baby:<\/strong> feeding, burping, naps, diapering\u2014plus unpredictability. Sleep debt reduces stress tolerance.<\/li> <li><strong>Preschooler:<\/strong> slow transitions (dressing, leaving, separations). Independence starts, but structure still supports them.<\/li> <li><strong>School-age:<\/strong> homework, tuition\/activity schedules, school messages. A simple evening method prevents a marathon.<\/li> <li><strong>Teen:<\/strong> fewer hands-on care tasks, more coordination, negotiation, and emotional support. Sleep can become irregular, anchors like shared meals help.<\/li> <\/ul> <h3 id=\"lifecontextwhythesameadvicedoesntsuiteveryfamily\">Life context: why the same advice doesn&#8217;t suit every family<\/h3> <p>Your available time depends on your setup:<\/p> <ul> <li><strong>Single parenting:<\/strong> fewer handoffs, fewer breaks. Simplifying becomes a health strategy.<\/li> <li><strong>Two-parent homes:<\/strong> coordination takes effort, but clear ownership reduces conflict.<\/li> <li><strong>Multiple children:<\/strong> overlapping needs make buffer time essential.<\/li> <li><strong>Working parents:<\/strong> dual load (work + home). Evenings are the most fragile zone.<\/li> <li><strong>Joint family \/ grandparents at home:<\/strong> support can be huge, but expectations and roles may need calm conversations.<\/li> <\/ul> <h3 id=\"akindresetfocusonstabilityinthisseason\">A kind reset: focus on stability in this season<\/h3> <p>The best <strong>parent time management<\/strong> approach is built around what your family needs most: safety, sleep, meals, transitions, and a few priorities that matter now. Not perfection. Less friction, more stability.<\/p> <h2 id=\"setprioritieswithoutguilthealthsafetystabilitythencomfort\">Set priorities without guilt (health, safety, stability, then comfort)<\/h2> <h3 id=\"wheneverythingfeelsimportantnothingfits\">When everything feels important, nothing fits<\/h3> <p>When the list is endless, use a simple hierarchy:<\/p> <ol> <li><strong>Physiology:<\/strong> sleep, nutrition, hydration, recovery.<\/li> <li><strong>Safety and care:<\/strong> illness, medicines, essential appointments, treatments.<\/li> <li><strong>Stability:<\/strong> school rhythm, emotional security, routines.<\/li> <li><strong>Comfort:<\/strong> a spotless home, many activities, total availability.<\/li> <\/ol> <p>Comfort can be enjoyable\u2014but it costs energy. Ask yourself: <em>What must still hold during a hard week?<\/em> A protected bedtime window? A basic dal-rice\/curd dinner? Ten minutes of calm connection?<\/p> <h3 id=\"urgentvsimportantafastfilterforparentdecisions\">Urgent vs important: a fast filter for parent decisions<\/h3> <p>When a new request arrives, sort it quickly:<\/p> <ul> <li><strong>Urgent + important:<\/strong> do it now (fever, asthma flare, true deadline).<\/li> <li><strong>Important, not urgent:<\/strong> schedule it (preventive care, weekly planning, rest).<\/li> <li><strong>Urgent, not important:<\/strong> delegate or simplify (some errands, optional requests).<\/li> <li><strong>Neither:<\/strong> reduce.<\/li> <\/ul> <p>Protecting &#8220;important but not urgent&#8221; time is where next week improves. This is a quiet superpower in <strong>parent time management<\/strong>.<\/p> <h3 id=\"maketheinvisiblevisiblelisttheinyourheadtasks\">Make the invisible visible: list the &#8220;in-your-head&#8221; tasks<\/h3> <p>A common couple-conflict point is visible chores vs invisible planning. Writing the invisible tasks down reduces mental load because what is visible can be shared.<\/p> <p>Try a quick list under headings:<\/p> <ul> <li>Health: vaccination reminders, refills, paediatrician follow-ups<\/li> <li>School: forms, fees, costume days, projects<\/li> <li>Food: groceries, snack planning, tiffin items<\/li> <li>Clothing: sizes, shoes, seasonal needs<\/li> <li>Home admin: bills, repairs, society work<\/li> <\/ul> <h3 id=\"measurerealtimereplaceimaginaryscheduleswithdata\">Measure real time: replace imaginary schedules with data<\/h3> <p>Choose 3\u20135 heavy daily tasks (cooking, bath, homework, bedtime, commute) and time them for a few days. Not to &#8220;perform,&#8221; only to see reality.<\/p> <p>Often bedtime is not 20 minutes but 45. Homework might be 30 minutes when everyone is fresh\u2014and 60 when fatigue hits. Accurate timing leads to kinder planning.<\/p> <h2 id=\"buildalightweightfamilysystemsimplesharedsustainable\">Build a lightweight family system (simple, shared, sustainable)<\/h2> <h3 id=\"fewerrulesstrongeranchors\">Fewer rules, stronger anchors<\/h3> <p>Systems last when they are light. Strong anchors include:<\/p> <ul> <li>A consistent evening sequence (dinner \u2192 bath \u2192 story \u2192 lights out)<\/li> <li>A fixed home for school items (bags, water bottles, ID cards)<\/li> <li>One weekly &#8220;messages\/admin&#8221; window (school emails, fees, forms)<\/li> <\/ul> <h3 id=\"sharetheloadownershipmeansdoitandthinkaboutit\">Share the load: ownership means &#8220;do it&#8221; and &#8220;think about it&#8221;<\/h3> <p>Splitting tasks is not only about doing. It is also about carrying responsibility for remembering and planning.<\/p> <p>Examples:<\/p> <ul> <li>One parent owns health logistics (pharmacy, refills, appointments).<\/li> <li>One parent owns clothing (sizes, replacements, uniform needs).<\/li> <li>Or: one parent cooks, the other plans the menu and grocery list.<\/li> <\/ul> <p>Sharing the thinking work reduces <strong>mental load<\/strong>, a core pain point in <strong>parent time management<\/strong>.<\/p> <h3 id=\"kidscanhelpautonomygrowsthroughrepetition\">Kids can help: autonomy grows through repetition<\/h3> <p>Children can contribute in age-appropriate ways:<\/p> <ul> <li>Small children: put toys away, clothes in the hamper<\/li> <li>School-age: fill water bottle, pack snack, keep shoes in one place, set the table<\/li> <li>Teens: manage their laundry, basic cooking, track deadlines<\/li> <\/ul> <p>It may be messy initially. That&#8217;s normal. Skills develop with repetition, not instant perfection.<\/p> <h3 id=\"clearhandoffsreducechaos\">Clear handoffs reduce chaos<\/h3> <p>A shared system (one calendar + one shared note\/list) can hold essentials: appointments, activities, homework, and any ongoing treatment plans. Clear handoffs reduce forgetting and help children feel secure.<\/p> <h3 id=\"parentingsolosimplifytolast\">Parenting solo: simplify to last<\/h3> <p>If you are parenting solo, choose short routines and fewer moving parts. Consider targeted support: carpool swaps, a trusted relative, occasional childcare, meal help. Even one protected recovery block per week changes capacity.<\/p> <h2 id=\"plantheweekfirstroutinesandrhythmcreaterealsavings\">Plan the week first: routines and rhythm create real savings<\/h2> <h3 id=\"theminiweeklymeeting1015minutes\">The mini weekly meeting (10\u201315 minutes)<\/h3> <p>Take 10\u201315 minutes, once a week.<\/p> <ul> <li>Open the calendar<\/li> <li>Place non-negotiables<\/li> <li>Assign coverage<\/li> <li>Add <strong>rest<\/strong> and buffer time<\/li> <\/ul> <p>A good question for children: &#8220;What would help mornings go more smoothly?&#8221; Sometimes the answer is simple: &#8220;Keep my socks ready.&#8221;<\/p> <h3 id=\"morningandeveningroutinesfewerdecisionslessconflict\">Morning and evening routines: fewer decisions, less conflict<\/h3> <p><strong>Morning:<\/strong> prepare at night\u2014clothes, bags, water bottles, lunch boxes. Keep the sequence consistent.<\/p> <p><strong>Evening:<\/strong> keep it short, predictable, and low-negotiation. Stable sleep supports attention, mood, immunity, and learning for children\u2014and emotional steadiness for adults.<\/p> <h3 id=\"homeworkandautonomybuildamethodnotabattle\">Homework and autonomy: build a method, not a battle<\/h3> <ul> <li><strong>Primary school:<\/strong> stable time, 5 minutes to set up, one task at a time. Checklist: take out materials \u2192 do work \u2192 put away.<\/li> <li><strong>Middle\/high school:<\/strong> focus on planning: what&#8217;s due, when, and what&#8217;s the first step.<\/li> <\/ul> <h3 id=\"weekendsavoidtheendlesscatchuptrap\">Weekends: avoid the endless catch-up trap<\/h3> <p>A simple structure helps:<\/p> <ul> <li>One logistics block (groceries, uniforms, batch prep)<\/li> <li>One family block (outing, games, visit)<\/li> <li>One rest block (quiet time, nap, walk)<\/li> <\/ul> <p>Rest lowers parental burnout risk and improves weekday functioning.<\/p> <h3 id=\"transitionsprotectthefragileendofdaywindow\">Transitions: protect the fragile end-of-day window<\/h3> <p>Transitions are hard for developing brains. Try a micro-routine after school\/work:<\/p> <ul> <li>Toilet + snack<\/li> <li>5\u201310 minutes to decompress<\/li> <li>Then one clear instruction at a time<\/li> <\/ul> <p>After office, a tiny decompression step (wash hands, change clothes, one slow breath) can reduce reactivity.<\/p> <h2 id=\"timeblockingthatworkswithkidsandreallife\">Time blocking that works with kids (and real life)<\/h2> <h3 id=\"blockthenonnegotiablesfirst\">Block the non-negotiables first<\/h3> <p>Start with anchors: sleep, drop-offs, pick-ups, meals, bedtime. In good <strong>parent time management<\/strong>, these are the foundation.<\/p> <h3 id=\"timeboxingstoptasksfromeatingtheday\">Timeboxing: stop tasks from eating the day<\/h3> <p>Use blocks with endpoints:<\/p> <ul> <li>20 minutes: school messages\/admin<\/li> <li>30 minutes: one household task<\/li> <li>15 minutes: prep tomorrow<\/li> <li>One phone-free family block<\/li> <\/ul> <p>When the timer ends, you stop or extend consciously.<\/p> <h3 id=\"buffertimescheduleslackonpurpose\">Buffer time: schedule slack on purpose<\/h3> <p>Build 10\u201320% margin for traffic, illness, slow transitions, forgotten items, and emotional meltdowns. Without slack, every surprise becomes a crisis.<\/p> <h2 id=\"practicalmethodsthatreducedecisionfatigue\">Practical methods that reduce decision fatigue<\/h2> <h3 id=\"batchingandchecklistsfewerinterruptionsfewerforgottenitems\">Batching and checklists: fewer interruptions, fewer forgotten items<\/h3> <p>Batch similar tasks to reduce context switching:<\/p> <ul> <li>School forms in one planned window<\/li> <li>Laundry sorting in one short sprint<\/li> <li>Bills and paperwork grouped together<\/li> <\/ul> <p>Checklists prevent the &#8220;missing item&#8221; spiral:<\/p> <ul> <li>School bag list<\/li> <li>Travel packing list<\/li> <li>Home first-aid\/medicine kit list<\/li> <\/ul> <h3 id=\"mealstemplatedinnersandmodestprep\">Meals: template dinners and modest prep<\/h3> <p>Meal planning is about reducing daily decisions:<\/p> <ul> <li>3\u20134 repeat dinners (for example: dal-chawal + sabzi, khichdi, dosa + chutney, roti + paneer\/egg)<\/li> <li>predictable snacks (fruit, sprouts, curd)<\/li> <li>lunch prep folded into the evening routine<\/li> <\/ul> <p>Modest batch prep helps: one carbohydrate base + one protein + vegetables, mix-and-match.<\/p> <h3 id=\"the2minuteruleandshortfocuscycles\">The 2-minute rule and short focus cycles<\/h3> <ul> <li>If it takes under two minutes, do it now (sign diary, reply, file, put away).<\/li> <li>For a tired brain: 10 minutes focus + 2 minutes pause, one clear goal.<\/li> <\/ul> <h3 id=\"decluttertoreducedailyfriction\">Declutter to reduce daily friction<\/h3> <p>Fewer items often means fewer decisions\u2014especially in the entryway, kitchen counter, and children&#8217;s room. Less friction is a quiet win in <strong>parent time management<\/strong>.<\/p> <h2 id=\"toolsautomationandsupportwithoutaddingburden\">Tools, automation, and support (without adding burden)<\/h2> <h3 id=\"choosetoolsyouactuallyopen\">Choose tools you actually open<\/h3> <p>The best tool is the one you check. Shared calendars, recurring lists, and reminders externalise memory and reduce mental load.<\/p> <h3 id=\"visualsupportsforchildren\">Visual supports for children<\/h3> <p>Simple visual routines (morning steps, evening steps) reduce nagging and support independence.<\/p> <h3 id=\"automatewhatyoucanuseyournetworkwherepossible\">Automate what you can, use your network where possible<\/h3> <p>Automation reduces repeated decisions:<\/p> <ul> <li>recurring payments<\/li> <li>repeating orders for essentials<\/li> <li>delivery or pickup when accessible<\/li> <\/ul> <p>Support also counts: carpool swaps, one pickup covered by a friend, a grandparent doing one homework sitting. Small help protects energy.<\/p> <h2 id=\"whentheweekgoesoffscriptprotectthebasicsandreducedemands\">When the week goes off-script: protect the basics and reduce demands<\/h2> <h3 id=\"protecthardevenings\">Protect hard evenings<\/h3> <p>After a heavy day, choose the simplest version:<\/p> <ul> <li>very simple dinner<\/li> <li>lower expectations<\/li> <li>earlier bedtime when possible<\/li> <\/ul> <p>Sleep protection improves tomorrow.<\/p> <h3 id=\"aminimumviabledayplan\">A minimum viable day plan<\/h3> <p>On unpredictable days, set a minimum:<\/p> <ul> <li>everyone fed and hydrated<\/li> <li>basic hygiene<\/li> <li>one school\/work essential<\/li> <li>one small connection moment<\/li> <li>bedtime protected as much as possible<\/li> <\/ul> <h3 id=\"sayingnoandnoticingparentalburnout\">Saying no and noticing parental burnout<\/h3> <p>Saying no can be a health decision. Signs overload may be building: persistent fatigue, irritability, forgetfulness, sleep problems, loss of pleasure, headaches, gut symptoms.<\/p> <p>If distress becomes severe, lasts, or includes thoughts of self-harm, seek urgent medical help.<\/p> <h2 id=\"keytakeaways\">Key takeaways<\/h2> <ul> <li><strong>Parent time management<\/strong> becomes easier when priorities stay realistic: physiology, safety, stability, then comfort.<\/li> <li>Measuring real time for cooking, commuting, homework, and bedtime reduces pressure and improves planning.<\/li> <li>Sharing both tasks and the thinking work reduces <strong>mental load<\/strong>.<\/li> <li>Morning\/evening routines plus buffer time protect the most fragile hours.<\/li> <li>Simple methods (time blocking, batching, checklists, the 2-minute rule, short focus cycles) save time and energy.<\/li> <li>Professionals can support you when things feel heavy. For personalised guidance and free child health questionnaires, you can download the <a href=\"https:\/\/app.adjust.com\/1g586ft8\" target=\"_blank\" rel=\"noopener\">Heloa app<\/a>.<\/li> <\/ul> <p><img decoding=\"async\" src=\"https:\/\/heloa.app\/wp-content\/uploads\/2026\/02\/gestion-du-temps-parent-in-article-image.jpg\" width=\"628\" alt=\"A young child tidying up his toys with his father helping illustrating good parent time management through routines\" \/><\/p>","protected":false},"excerpt":{"rendered":"<p>Parent time management, made doable: protect sleep, lighten mental load, and shape small routines that actually stick. A calmer, steadier week\u2014starting today.<\/p>\n","protected":false},"author":4,"featured_media":87580,"comment_status":"closed","ping_status":"","sticky":false,"template":"","format":"standard","meta":{"_acf_changed":false,"_kad_blocks_custom_css":"","_kad_blocks_head_custom_js":"","_kad_blocks_body_custom_js":"","_kad_blocks_footer_custom_js":"","_kad_post_transparent":"","_kad_post_title":"","_kad_post_layout":"","_kad_post_sidebar_id":"","_kad_post_content_style":"","_kad_post_vertical_padding":"","_kad_post_feature":"","_kad_post_feature_position":"","_kad_post_header":false,"_kad_post_footer":false,"_kad_post_classname":"","rank_math_title":"Parent time management: realistic sleep-smart routines","rank_math_description":"Parent time management, made doable: protect sleep, lighten mental load, and shape small routines that actually stick. A calmer, steadier week\u2014starting today.","rank_math_focus_keyword":"parent time management","rank_math_primary_category":891,"ilj_linkdefinition":["parent {-2} time management","time management {-2} for parents","parent {-2} time management tips","parent {-2} time management strategies","parent {-2} time management routine","parent {-2} time management system","family time management","time management {-2} for busy parents","time management {-2} with kids","parenting {-2} time management","managing time {-2} as a parent","time management {-2} for moms","time management {-2} for dads","time management {-2} for working parents","time management {-2} for families","time management {-2} at home with kids","parent {-1} schedule management","time planning {-2} for parents","parent daily routine","parent weekly planning"],"footnotes":""},"categories":[891,873],"tags":[],"class_list":["post-88024","post","type-post","status-publish","format-standard","has-post-thumbnail","hentry","category-daily-life-parents-2","category-parents-en-in"],"acf":{"prestation_table":"","technical_table":"","nom_professionnel":"","numero_telephone":"","convention_cas":"","contrat_acces_aux_soins":"","sesam_vitale":"","coordonnees":"","adresse":"","profession":"","numero_rpps":"","profession_description":"","commune":"","departement":"","prenom":"","origine":"","date_fete":"","signification_etymologie":"","histoire_origine_prenom":"","personne_celebre":"","age_moyen":"","prenoms_derives":"","prenoms_composes":"","naissances_2024":"","genre":"","prenoms_taxonomy":"","region_stats":"","evolution_naissances":""},"taxonomy_info":{"category":[{"value":891,"label":"Daily life"},{"value":873,"label":"Parents"}]},"featured_image_src_large":["https:\/\/heloa.app\/wp-content\/uploads\/2026\/02\/gestion-du-temps-parent-featured-image-1024x559.jpg",1024,559,true],"author_info":{"display_name":"Heloa","author_link":"https:\/\/heloa.app\/en-in\/author\/expert-heloa"},"comment_info":0,"category_info":[{"term_id":891,"name":"Daily life","slug":"daily-life-parents-2","term_group":0,"term_taxonomy_id":891,"taxonomy":"category","description":"","parent":873,"count":25,"filter":"raw","cat_ID":891,"category_count":25,"category_description":"","cat_name":"Daily life","category_nicename":"daily-life-parents-2","category_parent":873},{"term_id":873,"name":"Parents","slug":"parents-en-in","term_group":0,"term_taxonomy_id":873,"taxonomy":"category","description":"After your baby\u2019s arrival, it\u2019s perfectly natural to feel overwhelmed as a parent \u2014 with new responsibilities, sleepless nights, and emotions running high like a rollercoaster. New parents need support, and that\u2019s exactly what we\u2019re here for.","parent":0,"count":125,"filter":"raw","cat_ID":873,"category_count":125,"category_description":"After your baby\u2019s arrival, it\u2019s perfectly natural to feel overwhelmed as a parent \u2014 with new responsibilities, sleepless nights, and emotions running high like a rollercoaster. New parents need support, and that\u2019s exactly what we\u2019re here for.","cat_name":"Parents","category_nicename":"parents-en-in","category_parent":0}],"tag_info":false,"_links":{"self":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88024","targetHints":{"allow":["GET"]}}],"collection":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts"}],"about":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/types\/post"}],"author":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/users\/4"}],"replies":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/comments?post=88024"}],"version-history":[{"count":1,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88024\/revisions"}],"predecessor-version":[{"id":88025,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/posts\/88024\/revisions\/88025"}],"wp:featuredmedia":[{"embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/media\/87580"}],"wp:attachment":[{"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/media?parent=88024"}],"wp:term":[{"taxonomy":"category","embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/categories?post=88024"},{"taxonomy":"post_tag","embeddable":true,"href":"https:\/\/heloa.app\/en-in\/wp-json\/wp\/v2\/tags?post=88024"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}